PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AMDW01030998.1_FGP001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 107aa    MW: 12531.4 Da    PI: 8.2337
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AMDW01030998.1_FGP001genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS90.33.2e-281102234335
                   GRAS 234 lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                            ++P+v+v +  +  ++++ F++rf eal +ysa fd+l+a++pr+++er  +Er +lgr++ nv+acega+r+ r et+++W+ r ++
  AMDW01030998.1_FGP001   1 MRPHVFVQCVVNGAYGAPFFVTRFREALFFYSAHFDMLDATIPRDKDERLLIERDILGRWALNVIACEGADRVDRPETYKQWQVRNHR 88 
                            58************************************************************************************** PP

                   GRAS 322 aGFkpvplsekaak 335
                            aG+k++pl+ ++++
  AMDW01030998.1_FGP001  89 AGLKQLPLEAEVVE 102
                            ********998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035141.1E-251102IPR005202Transcription factor GRAS
PROSITE profilePS5098521.6581107IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MRPHVFVQCV VNGAYGAPFF VTRFREALFF YSAHFDMLDA TIPRDKDERL LIERDILGRW  60
ALNVIACEGA DRVDRPETYK QWQVRNHRAG LKQLPLEAEV VELVRNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370641e-147AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149671e-147AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615829.17e-66PREDICTED: scarecrow-like protein 9
SwissprotP0C8844e-42SCL34_ARATH; Scarecrow-like protein 34
TrEMBLA0A0E0J5K22e-66A0A0E0J5K2_ORYNI; Uncharacterized protein
STRINGLOC_Os11g47890.12e-65(Oryza sativa Japonica Group)
STRINGORGLA11G0190300.12e-65(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3741623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.13e-43GRAS family protein